IPLIST.NET - dayzairfield.weebly.com
Search for IP or hostnames:
dayzairfield.weebly.com checked at 2025-11-22T01:44:33.435Z 535ms 34/34/34 100% R:6 allDone:true timedOut:false dayzairfield.weebly.com
| A | 74.115.51.8🇺🇸 WEEBLY | ||||||
| PTR | wildcard.weebly.com | ||||||
| A | 74.115.51.9🇺🇸 WEEBLY | ||||||
| PTR | wildcard.weebly.com | ||||||
weebly.com
rank #64 in the tld
This domain, "weebly.com", is the official website for Weebly, a platform that provides tools for users to create free websites, blogs, or online stores. It's a popular platform used by individuals, businesses, and organizations to build and manage their online presence. The site offers customizable design templates, eCommerce tools, and marketing features. The service is known for its user-friendly interface, making it easy for anyone to create a professional-looking website.
AI analysis
dayzairfield.weebly.com resolves to two IPs: 74.115.51.8 and 74.115.51.9.
other host names for instance forfait-internet.weebly.com, softmill.weebly.com, kidkraftkitchenkidkraftplaykitch.weebly.com, japan.wildcaveman.weebly.com and facingclassism.weebly.com share IP numbers with dayzairfield.weebly.com.
dbq